COPE Media Kit


Cope Home
Previous entry:
Ribonucleotide reductase
Next entry:
ribosomal protein L1
Random entry:
LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC
Search COPE:

ribophagy

This term refers to the selective degradation of ribosomes through autophagy by means of autophagolysosomes especially under conditions of starvation. In yeast, the process has been shown to rely on core autophagy components such as ATG1 and ATG7. This specific process, but not bulk autophagy, also requires the ubiquitin protease Ubp3 and its cofactor Bre5. A catalytically inactive mutant of Ubp3 displays a defect in the autophagy-mediated degradation of ribosomes, indicating that ubiquitination plays a key role in this process (Kraft et al, 2008; for overview see also: Cebollero et al, 2012).

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: September 2017



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=43898