COPE Advertising options



Previous Next
Search COPE:
 


- K -

Select one of the following:


k

K1
K1CS
K1L protein
K1 protein

K2
K2R

K3 opiate receptor
K3R

K-4

K-5

K6

K7
K-7/D-6
K7 protein
K7R protein

K8-alpha
K8-bZIP

K9CATH

K12
K12 protein
K13
K14
K15
K1-5
K15T peptide
K17
K18
K19

K4.1
K4.2

K5-5

K60

K108-K133
K-119

K203
K237 peptide
K252a

K562-derived T-cell inhibitory factor
K562-IF

K1(104-124)

KA cells
KA′ cells
KA″ cells
KACL
KADGIVSKNF
KAEFHRWSSYWVHWKNQFDHYSKQDRCSDL
KAEWKSLGEEAWHSK
KAF
KAFDITYVRLKF
KAI1
KAI1/CD82-associated surface protein
KA interneurons
KAKAKAVSRSARAGLQFPVGRIHRHLK
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
KAL
KAL2
KALI
kalinin
kalinin B1
kalinin B2
Kaliocin-1
kaliuretic hormone
kaliuretic peptide
Kallmann syndrome 2
Kallidin
Kallidin-10
Kallidin I
Kallidin II
kallidinogen
Kallikrein-1
Kallikrein-2
Kallikrein-3
Kallikrein-4
Kallikrein 5
Kallikrein 6
Kallikrein-8
Kallikrein 13
Kallikrein 14
kallikrein B1
kallikrein-binding protein
kallikrein Klk1b3
kallikrein Klk1b4
Kallikrein-like 4
Kallikrein-like protein 1
Kallikrein-like protein 2
kallikrein protein 5
kallikrein-related peptidase 2
kallikrein-related peptidase 3
Kallikrein-related peptidase 4
Kallikrein-related peptidase 5
Kallikrein-related peptidase 6
Kallikrein-related peptidase 8
kallikrein-related peptidase 13
Kallikrein-related peptidase 14
kallikrein-related peptidase-like 4
Kallikreins
Kallistatin
KAMP-19
KAMPs
KA neurons
KA′ neurons
KA″ neurons
KANGAI-1
kaposica
Kaposi-FGF
Kaposi fibroblast growth factor
kaposin
Kaposin A
Kaposin B
Kaposin C
Kaposi sarcoma-associated herpesvirus
Kaposi sarcoma-associated herpesvirus BCL2 protein
Kaposi sarcoma-associated herpesvirus CARD7
Kaposi sarcoma-associated herpesvirus DEFCAP
Kaposi sarcoma-associated herpesvirus dUTPase
Kaposi sarcoma-associated herpesvirus FLICE-inhibitory protein
Kaposi sarcoma-associated herpesvirus NAC
Kaposi sarcoma-associated herpesvirus NALP1
Kaposi sarcoma-associated herpesvirus NLRP1
Kaposi sarcoma-associated herpesvirus orf54 protein
Kaposi sarcoma-associated herpesvirus orf57
Kaposi sarcoma-associated herpesvirus orf63
Kaposi sarcoma FGF
Kaposi sarcoma oncogene
Kaposi sarcoma protein
Kaposi's sarcoma-associated herpes virus latency-associated nuclear antigen
Kappa-casecidin
Kappa-casein
kappa-casein(17-21)
kappa-casein(18-24)
kappa-casein(25-34)
kappa-casein(30-32)
kappa-casein(31-34)
kappa-casein(35-41)
kappa-casein(42-49)
kappa-casein(43-97)
kappa-casein(58-61)
kappa-casein(61-64)
kappa-casein(64-75)
kappa-casein(57-134)
kappa-casein(89-109)
kappa-casein(103-111)
kappa-casein(106-112)
kappa-casein(106-116)
kappa-casein(106-124)
kappa-casein(106-169)
kappa-casein(108-110)
kappa-casein(112-116)
kappa-casein(113-116)
kappa-casein(118-121)
kappa-casein(139-146)
kappa-casein(141-146)
kappa-casein(158-164)
kappa-casein(162-169)
kappa-casein(163-171)
kappa-casein(165-171)
kappa-casein(185-190)
kappa-casein-A
kappa-casein-B
kappa-Caseinoglycopeptide
Kappacin
Kappacin A
Kappacin B
kappaE
kappa-elastin
Kappa-Interferon
Kappa-type 3 opioid receptor
Kappe neurons
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFamide
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
KARS
KARS1
KARS2
karyochrome cells
karyolysis
Karyoptosis
karyorrhexis
KAS
KASH domain
Kashchenko-Hofbauer cells
KASP
Kass
Kassinatuerin-1
Kassinatuerin-2
Kassinatuerins
Kassinin
kassorin M
kassorin S
kassorins
Katacalcin
KATO-III cell-derived stomach cancer amplified gene
KAYSMPRCKGGFRAVMCWLamide
KAYSMPRCKYLFRAVLCWLamide
KAYSTPRCKGLFRALMCWLamide
KAZALD1
Kazal-type protease inhibitor domain-containing protein 1

KBP

KC
KC21 peptide
KCA
K-CAD
K-cadherin
KCAF
K cells
KCFQWQRNMRKVRGPPVSCIKR
KCHIP3
KC-HSF
KCIP-1
KCNIP3
KCNTATCA
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYamide
KCP
KCP1
KCRRRKVHGPMIRIRKK
KC-T
KCT3
KCT-4

KD83
KDAF
KDAMPs
KDAMP 13-mer
KDAMP 14-mer
KDAMP 17-mer
KDAMP 18-mer-C
KDAMP 18-mer-N
KDAMP 19-mer
KDAP
KDCERRFSRSDQLKRHQRRHTGVKPFQ
KDEI
KDEL
KDEPQRRSARLSAKPAPPKPEPKPKKAPAKK
KDI peptide
KDKAMLFTYDQYQENNVDQASGS
KDLPNYNWNSFGLRF
KDM3B
KDM3B(324-332)
KDM4A(820-839)
KDM5B
KDQDK
KDR
KDR288-297
KDR-binding protein
KDR-bp
KDRF
KDRL
KDR-like
KDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVG
KDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN

KEC
KEDL
Keep-out signals
Kek-6
KEKIGKKKRQKKRKAAQKRKN
kekkon-6
KEL
K-elastin
Kell blood group antigen
Kell protein
ken
ken and barbie
KEN-box
kenny
kenpaullone
KENWVQRVVEKFLKRAENS
Kenyon cells
Kenyon cells expressing FoxP
kep1
Keratan sulfate proteoglycan fibromodulin
keratin 6A
keratin 6A-derived antimicrobial peptides
keratin-7
keratin-15
Keratin-18
keratin-19
keratin D
keratin-derived antimicrobial peptides
keratinization
keratinized cells
keratinocyte-associated C-type lectin
keratinocyte-associated protein 1
keratinocyte-associated transmembrane protein 3
keratinocyte chemoattractant
Keratinocyte Cytokine
Keratinocyte-derived amphiregulin
keratinocyte-derived anti-fibrogenic factor
Keratinocyte-derived autocrine factor
keratinocyte-derived chemokine
Keratinocyte-derived T-cell growth factor
keratinocyte differentiation-associated protein
Keratinocyte epidermal cell-derived thymocyte-activating factor
Keratinocyte growth factor
Keratinocyte growth factor-1
Keratinocyte growth factor-2
keratinocytes
Keratinocytes associated transmembrane protein 4
keratin, type I cytoskeletal 19
keratoblasts
keratocytes
Kerato-epithelin
keratolinin
Keratosis palmoplantaris transgrediens of Siemens
Keren
KESVRLCGLEYIRTVIYICASSRW
KETc7(69-85)
Kette
KETWWETWWTEWSQPKKKRKV
key

KFEPKSGWMTFLEVTGKIAEMLSLLKQYC
KFERQ
KFFKRLLKSVRRAVKKFRKKPRLIGLSTLL
KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF
K-FGF
KFHEKHHSHRGY
KFHEKHHSHRGYR
KFLKKAKKFGKAFVKIL
KFRKTCAPMGYCSPKCRVMDLKYTSGDCKYSCCIPTAWKGK

KG-1
KG1a
KGAAKGLLEVASCKLSKSC
KG-CAM
KGF
KGF-1
KGF-2
KGFR
KGF receptor
KGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
KGHK
KGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLE
K-glypican
K-GM
KGRGKQGGKVRAKAKTRSS
KGRREEKVGKKEKIGKKKRQKKRKAAQKRKN
KGYGGVSLPEW

KH97
KH domain
KH domain encompassing protein 1
KHF
KHGamide
KHGHGHGKHKNKGKKN
K homology domain
K-homology splicing regulator protein
KHSRP
KHSSG
KHSSGCAFL
KH type-splicing regulatory protein

Ki-1
Ki-2
Ki-24
KIAA0003
KIAA0012
KIAA0021
KIAA0022
KIAA0069
KIAA0070
KIAA0071
KIAA0100
KIAA0121
KIAA0141
KIAA0147
KIAA0164
KIAA0183
KIAA0185
KIAA0207
KIAA0214
KIAA0216
KIAA0226
KIAA0230
KIAA0261
KIAA0268
KIAA0271
KIAA0281
KIAA0289
KIAA0300
KIAA0315
KIAA0317
KIAA0331
KIAA0333
KIAA0358
KIAA0364
KIAA0366
KIAA0369
KIAA0394
KIAA0396
KIAA0407
KIAA0413
KIAA0425
KIAA0429
KIAA0443
KIAA0463
KIAA0468
KIAA0472
KIAA0491
KIAA0519
KIAA0525
KIAA0533
KIAA0537
KIAA0543
KIAA0548
KIAA0550
KIAA0567
KIAA0571
KIAA0578
KIAA0605
KIAA0620
KIAA0623
KIAA0634
KIAA0641
KIAA0653
KIAA0670
KIAA0671
KIAA0688
KIAA0709
KIAA0722
KIAA0743
KIAA0762
KIAA0767
KIAA0770
KIAA0771
KIAA0784
KIAA0816
KIAA0831
KIAA0859
KIAA0873
KIAA0886
KIAA0926
KIAA0932
KIAA0943
KIAA0938
KIAA0950
KIAA0955
KIAA0960
KIAA0971
KIAA0975
KIAA0976
KIAA0989
KIAA1036
KIAA1070
KIAA1071
KIAA1079
KIAA1098
KIAA1151
KIAA1163
KIAA1178
KIAA1180
KIAA1199
KIAA1206
KIAA1207
KIAA1220
KIAA1225
KIAA1226
KIAA1233
KIAA1271
KIAA1289
KIAA1293
KIAA1312
KIAA1315
KIAA1336
KIAA1346
KIAA1366
KIAA1368
KIAA1419
KIAA1436
KIAA1438
KIAA1445
KIAA1450
KIAA1479
KIAA1480
KIAA1482
KIAA1488
KIAA1502
KIAA1531
KIAA1540
KIAA1550
KIAA1561
KIAA1565
KIAA1566
KIAA1568
KIAA1580
KIAA1589
KIAA1619
KIAA1624
KIAA1655
KIAA1663
KIAA1733
KIAA1736
KIAA1745
KIAA1763
KIAA1777
KIAA1780
KIAA1785
KIAA1809
KIAA1810
KIAA1815
KIAA1822
KIAA1822L
KIAA1834
KIAA1851
KIAA1857
KIAA1861
KIAA1867
KIAA1869
KIAA1873
KIAA1892
KIAA1907
KIAA1916
KIAA1928
KIAA1953
KIAA1976
KIAA1983
KIAA2025
KIAA2036
KIAA3001
KIAA4294
KIAEKFSGNRR
KIAKVALKAL
KIAP
KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN
kidney A-intercalated cells
Kidney angiogenic factor
kidney B-intercalated cells
kidney brush-border neutral proteinase
kidney cadherin
kidney enkephalinase
kidney-expressed chemokine
Kidney growth factor
Kidney inhibitor of apoptosis
Kidney injury molecule 1
kidney intercalated cells
kidney juxtaglomerular cells
Kidney-type arginase
Kielin
kielin/chordin-like protein
kielin-like protein
Kif1C
KIF7
KIKIPWGKVKDFLVGGMKAV
KIKSCYYLPCFVTSKN
KIKWFKTMKSIAKFIAKEQMKKHLGGE-OH
KIKWFKTMKSLAKFLAKEQMKKHLGE
KILLER
Killer cell helper factor
Killer cell immunoglobulin-like receptor 2DL1
Killer cell immunoglobulin-like receptor 2DL2
Killer cell immunoglobulin-like receptor 2DL3
Killer cell immunoglobulin-like receptor 2DL4
Killer cell immunoglobulin-like receptor 2DS1
Killer cell immunoglobulin-like receptor 2DS2
Killer cell immunoglobulin-like receptor 2DS3
Killer cell immunoglobulin-like receptor 2DS4
Killer cell immunoglobulin-like receptor 2DS5
Killer cell immunoglobulin-like receptor 3DL1
Killer cell immunoglobulin-like receptor 3DL1/3DS1
Killer cell immunoglobulin-like receptor 3DL2
Killer cell immunoglobulin-like receptor 3 domains pseudogene 1
Killer cell immunoglobulin-like receptor 3DS1
Killer cell inhibitory receptor 103AS
killer cell lectin-like receptor
killer cell lectin-like receptor G1
killer cell lectin-like receptor subfamily B member 1
killer cell lectin-like receptor subfamily C member 1
killer cell lectin-like receptor subfamily C member 2
killer cell lectin-like receptor subfamily C member 3
killer cell lectin-like receptor subfamily C member 4
killer cell lectin-like receptor subfamily D member 1
killer cell lectin-like receptor subfamily F member 1
Killer cell lectin-like receptor subfamily F member 2
killer cell lectin-like receptor subfamily K member 1
Killer cells
Killer dendritic cells
Killer factor
killerFLIP
killerFLIP-E
Killer helper factor
killer lectin-like receptor
Killer of prune
killer-specific secretory protein of 37 kDa
Killer T-cell activating factor
killing peptides
Kilon
KILRGVCKKIMRTFLRRIamide
KILRGVCKKIMRTFLRRISKDILTGKKamide
KIM-1
Ki-M6
Ki-M7
Ki-M8
Kinase insert
Kinase insert domain receptor
Kinase insert domain receptor-like
kinase interaction motif
Kinase/phosphatase/inhibitor 2
Kinase phosphorylated during mitosis
Kinase receptor activation assay
Kinase responsive to stress-1
Kinase responsive to stress-2
KINATDADEPNTLNSKISYR
KIND3
kindlin-3
kindred of IgLON
Kineret
kinesin family member 7
Kinesin-like protein costa
Kinestatin
kinetensin
kineticins
Kinin-9
kininase 2
kininases
kinin-inactivating enzymes
Kininogen
Kininogen-1
kininogen-2
kininogen(267-282)
kininogen(275-290)
kininogen(438-531)
kininogen(480-495)
kininogen(488-503)
kininogen D5 domain
Kininogen fragment 1.2
Kininogenin
Kininostatin
kinins
Kinocidins
kin of irre
Kin of irregular chiasm-like protein 3
kin of IRRE like 3
KIPLPRFKLKCIFCKKRRKR
KIR2DL1
KIR2DL2
KIR2DL3
KIR2DL4
KIR2DS1
KIR2DS2
KIR2DS3
KIR2DS4
KIR2DS5
KIR3DL1
KIR3DL1/3DS1
KIR3DL2
KIR3DP1
KIR3DP1*004
KIR3DS1
KIR-103AS
KIRA
KIR family
KIR-K6
KIRL1
KIR-like-1
KIRRE
KIRREL3
KISLQRLKSYVITTSRCPQ
KISQYYQK
KISS1
Kiss1 neurons
KISS1R
KISS1 receptor
KISS-2
KISS2R
KISS2 receptor
KISS3
KISS1(107-121)
KISS1(112-121)
Kiss-and-run exocytosis
Kiss-and-run fusion
Kissorphin
kisspeptin-1
Kisspeptin-1 receptor
kisspeptin-2
Kisspeptin-2 receptor
Kisspeptin-3
Kisspeptin-10
Kisspeptin-13
Kisspeptin-14
kisspeptin-54
Kisspeptin-145
kisspeptin/neurokinin B/dynorphin neurons
kisspeptin neurons
Kisspeptins
kit
Kit225
KITL
KITL1
KITL2
KITLG
Kit ligand
Kit ligand-1
Kit ligand-2
Kit(sh/sh) mice
Kit(W)
Kit(W-sh) mice
Kit(W-sh/W-sh)
Kit(Wv)
Kit(W/W)
Kit(W/Wv)

Kjr

KK34
KKA3
KKAYQLEHTFQGLLamide
KKFKETADKLIESAKQQLESLAKEMK
K-Kininogens
KKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPY
KKKEERADLIAYLKKA
KKKQKNGKKHQKK
KKKQKNGKKHQKKKVLKVRK
KKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
KKLFKKILKKL
KKLQGKGPGGPPPK
KKNAPPEPVPPPRAAPAPTHV
KKRLKKIFKKPMVIGVTIPF
KKRPKPGGWNTGGSRYPGQG
KKSCHTGLDRSAGWVIPIGTLVKKAILPWDRK
KKSCHTGLKKSAGWVIPIGTLVKNGIIVR
KKTCIVHKMKKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGL
KKTSMKIIPFTRL
KKVLKVRKSQRSRQKKTT
KKYKVPQ

KL
KL-1
KL-2
KL-6
KLA
KLAKLAK
KLAKLAK(2)
KLAKLAKKLAKLAK
KLALKLALKALKAALKLAamide
KLAL peptide
K-laminin
KLA peptide
KLB
KLF1
KLF2
KLF2a
KLF2b
KLF4
KLF4-alpha
KLF4-beta
KLF4-delta
KLF4-gamma
KLF10
KLF11
KLG
KLK1
Klk1b3
Klk1b4
KLK2
KLK3
KLK4
KLK5
KLK6
KLK8
KLK13
KLK14
KLKB1
Klkbp
KLKL1
KLKL2
KLKL4
KLKL5KLK
KLKLLLLLKLK
KLKR
K locus
Klotho
Klotho-beta
Klotho-gamma
Klotho-lactase-phlorizin hydrolase-related protein
Klotho-LPH related protein
KLPGWSG
KLPH
KLR
KLRB1
KLRB1D
KLRC1
KLRC2
KLRC3
KLRC4
KLRD1
KLRF1
KLRF2
KLRG1
KLRK1
KLRVDPVNFKLLSH
KLS cells
KLSYDDKVFENVEFTPRL

KM102
KM102-BPA
KM102 burst promoting activity
KM-102-derived reductase-like factor
KMT-2
KMYDFGL

kn
KN2
Kn(a)
Kn(b)
KND peptide
KNDy neurons
KNECLWTDMLSNFGYPGYQSKHYACIRQKG
KNEL
KNEVEEEAKTP
KNG
KNG1
KNG2
knizocytes
KNK10
KNKGKKNGKH
KNLRRIIRKIIHIIKKYG
knock-down
Knock-out
Knops blood group antigen
Knops-Helgeson antigen
knot
knottin motif
knottins
Knotty amacrine cells
KNQDK
KNSFMALYLSKG
KNTMEHVSSSEESIISQETYKQEKNMAINPSK

KO(a)
Ko alloantigen
KO(b)
kodocytes
Koebnerisin
Kohjirin
koilocytes
Kolmer-Agduhr cells
Kolmer-Agduhr interneurons
Kolmer-Agduhr neurons
Kolmer cells
Kolmer epiplexus cells
Kolmer phagocytic cells
Kolt-2
Komeda Zucker creeping rats
KO mice
koniocellular cells
Körnchenzellen
KOP
KOR-3
Kostmann syndrome

KP-1
Kp-10
Kp-13
Kp-14
KP43
KP-54
Kp-145
KPB-M15
KPB-M15-CSA
KPB-M15 derived colony stimulating activity
KPI-2
KPKRKRRKKKGHGWSR
KPL-4
kpm
KPMM2
K-pn
KPNPERFYGLMamide
KPPPWVPV
KPPSSSEFIGLMamide
KPPSSSEFVGLMamide
KPQLWP
KPRPDQFYGLMamide
KPS-1
Kpsn
KPSSPPEEamide
KPV
KPWNFFKEIERAVARTRDAVISAGPAVATVAAASAVASG
KPWNFFKEIERAVARTRDAVISAGPAVATVGAAAAVASG
KPYCSCKWRCGIGEEEKGICHKFPIVTYVCCRRP

KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI
KQEGRDHDKSKGHFHMIVIHHKGGQAHHG

Kr
KR-11 peptide
KR-12
KR-20
KR20 peptide
kranocytes
kra
krapfen
KRASIM
KRAS-interacting microprotein
Kr-bodies
Kreb's bodies
Krebs von den Lungen-6
KREMEN
KREMEN1
KREMEN2
KRF17
KRFGRLAKSFLRMRILLPRRKILLAS
KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS
KRFIKWYNAWNEKRRVY
KRFKKFFKKLKNSVKKRVKKFFRKPRVIGVTFPF
KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF
KRFKQDGGWSHWSPWSS
KRFYVVMWKK
KRGDCIKMCMRDLRRKLIRLKLRNSK
KRHHGYK
KRHHGYKR
kringle
kringle containing transmembrane protein
kringle containing transmembrane protein 1
kringle containing transmembrane protein 2
kringles 1-5
KRIVQRIKDFLRamide
KRIVQRIKDFLR
KRIVQRIKDFLRNLVPRTES
KRLRRVWRRWRamide
KRM
KRM1
KRM2
Krn
KRNRNNIA
krox
Krox-20
Krox-24
KRPPGFSPFR
KRPPGFSPF
KRPWIL
KRRHWFPLSFQEFLEQLRRFRDQLPFP
KRS
KRS1
KRS2
KRSFSGFGSPLDRLSAGSVDHK
KRT6A
KRT7
KRT15
KRT18
KRT19
krtdap
Krueppel
Krüppel
Krüppel-like factor 1
Krüppel-like factor 2
Krüppel-like factor 2a
Krüppel-like factor 2b
Krüppel-like factor 4
Krüppel-like factor 10
Krüppel-like factor 11
Krüppel-like factors
Krüppel-like transcription factor
Krüppel-like transcription factor 1
KRWNSCKQNKQGANSRPVNQTPPPEGEKL

KS1
KS3
KS1/4 antigen
KS23 peptide
KS-27
KS-30
KSA
K-sam
KSBCL2
KSCCRNTTARNCYNVCRIPG
KSCCRNTVARNCYNVCRIPGTPRPVCAATCDCKLITGTKCPPGYEK
KSCCRSTQARNIYNAPRFAGGSRPLCALGSGCKIVDDKKTPPND
KSCCRSTTARNIYNGCRVPGTARPVCAKKSGCKIQEAKKCEPPYD
KSDVRRWRSRY
KS-FGF
KSFNSCFGTRMDRIGSWSGLGCNSLKNGTKKKIFGN
KSHV
KSHV BCK protein
KSHV BCL2 protein
KSHV dUTPase
KSHV FLICE-inhibitory protein
KSHV-FLIP
KSHV GPCR
KSHV K6 protein
KSHV K12 protein
KSHV K4.1 protein
KSHV K4.2 protein
KSHV kaposin
KSHV K-bZIP
KSHV LANA
KSHV LANA-1
KSHV latency-associated nuclear antigen
KSHV latency-associated nuclear antigen 1
KSHV Lyta
KSHV MTA
KSHV orf4
KSHV orf7
KSHV orf16
KSHV orf45
KSHV orf50
KSHV orf54 protein
KSHV orf57
KSHV orf63
KSHV orf71
KSHV ORF73
KSHV orf74
KSHV orfK1
KSHV orfK2
KSHV orfK4
KSHV orfK5
KSHV orfK6
KSHV orfK7
KSHV orfK9
KSHV orfK10
KSHV orfK11
KSHV orfK12
KSHV orfK13
KSHV orfK14
KSHV orfK15
KSHV orfK15-M
KSHV orfK15-P
KSHV orfK4.1
KSHV orfK10.5
KSHV OX2
KSHV RTA
KSHV viral IL6
KSHV viral MIP-1-alpha
KSHV viral MIP-2
KSKEKIGKEFKRIVQRIKDFLRNLVPR
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
KSL cells
KSO peptide
Ksp37
KSPG25
KSPG fibromodulin
KS protein
KSRIVPAIPVSLLamide
KSRP
KSSAYSLQMGATAIKQVKKLFKKWGW
KST
KSTRKS
KSVRGKGKGQKRKRKKSRYK
KSVRTWNEIIPSKGCLRVGGRCHPHVNGGGRRRRRRRRR
KSVWHGSDPNGRRLT

KT2 peptide
KT-3
KT-7515
KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC
KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC
kte
KTGF
K-TIF
KTLS cells
KTNMKHMAGAAAAGAVVGGLG
KTRNWFSEHFKKVKEKLKDTFA
KTTKS
KTYFPHFDLSHGSAQVKGHGAK

Ku70
Ku70-binding protein 1
KU-19-19
KU-19-20
Ku antigen
Ku autoantigen
KUB1
Kulchitsky cells
Kultschitzky cells
Kunitz domain-containing protein overexpressed in pancreatic cancer
Kupffer cell activating factor
Kupffer cell derived hepatocyte stimulating factor
Kupffer cells
kuz
Kuzbanian
Kuzbanian homolog
KUZL
KUZS

KVAKQEKKKKKTGRAKRR
Kv channel-interacting protein-3
KVEIVAINDPFIDL
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNF
KVHGSLARAGKVRGQT
KVKARLIKICNKIGFLKSRCHKFVITH
KVKFSAWGamide
KVLPVP
KVLPVPQ

KW-7
KW-8
KW-2228
KW-5139
KWCFRVCYRGICYRKCRamide
KWCFRVCYRGICYRRCRamide
KWKLFKKIGIGAVLKVLTTGLPALISamide
KWKLFKKIPKFLHLAKKFamide
KWLRRVWRWWRamide
KWRLLIRWRIQKamide
KWVQNYMKHLGRKAHTLKT

Kx antigen

KYCPKVGY
KYE21
KYE28
KYEITTIHNLFRKLTHRLFRR
KYEITTIHNLFRKLTHRLFRRNFGYTLR
KYLGPQY
KYM-1D4
KYNA receptor
Kynurenic acid receptor
kyotorphin
KYSFKLILAEY

KZC rats



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.