KAEFHRWSSYWVHWKNQFDHYSKQDRCSDL |
KAF |
RNA helicase-DEAD box protein 116 |
||
This fragment of NCAM [neural cell adhesion molecule] corresponds to Encamin C. See: Encamins.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |