killer cell lectin-like receptor subfamily C member 1 |
killer cell lectin-like receptor subfamily C member 3 |
NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK |
||
see: KLRC2. In the nomenclature of CD antigens this protein has been given the designation CD159c.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |