kalinin B2 |
kaliuretic hormone |
TRIM29 |
||
Kaliocin-1 is a synthetic peptide of 31 amino acids (FFSASCVPGADKGQFPNLCRLCAGTGENKCA). The Lactoferrin(152-182) sequence is based on homologies common to all members of the transferrin family proteins (positions 152-182 of human lactoferrin). Kaliocin-1 has fungicidal activity against Candida spp., including fluconazole- and amphotericin B-resistant clinical isolates (Viejo-Diaz et al, 2005). Kaliocin-1, and lactoferrin show a bactericidal effect at low-ionic-strength conditions. The antimicrobial effect of kaliocin-1 is lower than that of human lactoferrin. The peptide also mimics native lactoferrin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |