kuz |
Kuzbanian homolog |
APPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEV |
||
The Drosophila melanogaster kuzbanian (kuz) gene (CG7147) is expressed in the nervous system. It encodes a member of the zinc metalloproteinases with a disintegrin domain and the protein thus is a member of the ADAM protein family. The protein is highly conserved and is closley related to the TNF-alpha converting enzyme (TACE). The mammalian homolog is ADAM10 [a disintegrin and metalloprotease domain 10].
The protein is essential for the partitioning of neural and nonneuronal cells during development of both the central and peripheral nervous systems in Drosophila melanogaster
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |