KDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN |
KEDL |
C6-beta-Chemokines |
||
[kidney-expressed chemokine] a designation found in sequence databanks for one of the chemokines. Sequence databank entries reveal identity of BMAC, bolekine, BRAK, KEC, KS1, MIP-2-gamma, NJAC. According to a new systematic nomenclature the name CXCL14 has been proposed for this factor. The factor is known also as SCYB14 [small inducible cytokine subfamily B member 14]. The approved gene symbol is CXCL14.
This factor is known mainly because of its chemotactic activity. For an unrelated function as an
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |