KACL |
KAEFHRWSSYWVHWKNQFDHYSKQDRCSDL |
intermediate type neuroblastoma cells |
||
This peptide corresponds to RPS21(74-83) [40S ribosomal protein S21(74-83)]. See: ribosomal protein S21.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |