COPE Advertising options



Previous Next
Search COPE:
 


- W -

Select one of the following:


W

W7C5

W211
W233
W239
W272

W3/13
W3/25

wa-1
wa-2
WA-8
Wa antigen
Waardenburg-Shah syndrome 4
Waardenburg syndrome 2E
Waardenburg syndrome 4C
Wads mice
Wag31
WAGGDASGE
WAH-1
Waldemar Kolanus
Waldner antigen
Waldner blood group antigen
Walleye dermal sarcoma virus orfC protein
wandering cells
WAP2
WAP3
WAP 4-disulfide core domain 1
WAP 4-disulfide core domain 2
WAP 4-disulfide core domain protein 14
WAP-4-DSC domain
WAP7
WAPAL
WAP domain
WAP four-disulfide core domain 5
WAP four-disulfide core domain 7
WAP four-disulfide core domain 12
WAP four-disulfide core domain 15B
WAP four-disulfide core domain 17
WAP four-disulfide core domain 21 pseudogene
WAPL
WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2
WARR
Warranty Notice
Warrior antigen
Warrior blood group antigen
WARS
WARS1
WARS2
Warthin-Finkeldey cells
Warthin-Finkeldey-like cells
warts
warts-1
WARYADWLFTTPLLLLDLALLV
Washington University Cell Adhesion Molecule
WASP homology domain 1
WASP homology domain 2
WASP-interacting SH3 protein
wasserhelle cells
wasted
wasted away
WAT-cells
water-clear cells
Waterfall cells
Waterfall 1 cells
Waterfall 2 cells
water-soluble tetrazolium
WATIDECEETCNVTFKTCCGPPGDWQCVEACPV
waved-1
waved-2
wax cells

Wb blood group antigen
WBS

WC6
WC10 antigen
W cells
WCPPMIPLCSRFamide

WD
WD40 domain
Wda
WD blood group
WD domain
WDLAWMFRLPVG
WDNLDSDIRR
Wdnm1-like
WDR26
WDR30
WDR35
WDR40A
WDR92
WDR94
WDR cells
WD repeat and socs box-containing protein-1
WD repeat-containing protein 26
WD repeat-containing protein 30
WD repeat-containing protein 92
WD repeat domain 30
WD repeat domain 35
WD repeat domain 40A
WD repeat domain 94
WDR neurons
WDWLPW

WE-14
WE-15
Webb blood group antigen
WECHE
Wedge-shaped amacrine cells
Wedl cells
Wegener Autoantigen
WEHD
WEHD-AFC
WEHDase
WEHD-fmk
WEHI-231 BCGF-2
WEHI-3B
WEHI-3B differentiation inducing activity
WEHI 3 growth factor
WEHI 3 hematopoietic growth factor
WEHI-164
WEHI mesoderm inducing factor
WEHI-MIF
Weibel-Palade bodies
weissherbst
Wellferon
wellville
WELVVLGKL
Wengen
Wepo
WERRPFSEDVNWGYE
WES(a) antigen
WES(b) antigen
West Nile virus envelope protein E
WEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC

wf
WF-1
WFDC1
WFDC2
WFDC12
WFDC14
Wfdc15b
Wfdc17
WFDC21P
WFLGLNKEGQAMKG
WFGDVNQKPIRSPSLRLRLamide
WFGHCTYWLGPCVDDTCCSASCSKFCGLW
WFIKKN2
WFLGLNKEGQIMKG
WFMAFTRQGRPRQA
WFVGLKKNGSCKRG

Wg
WGF
WGFE
wgn

WH1 domain
WH2 domain
Wharton's jelly cells
Wharton's jelly-derived mesenchymal stem cells
Wharton's jelly mesenchymal stem cells
Wharton's jelly mesenchymal stem/stromal cells
Wharton's jelly mesenchymal stromal cells
What to avoid when writing scientific articles
WHD
WHEP domains
whey acidic protein domain
Whey acidic protein 2
Whey acidic protein 3
whey growth factor extract
WHIM syndrome
white adipocytes
white adipose cells
white blood cells
white cells
white fat cells
white matter interstitial cells
white matter interstitial neurons
white matter neurons
white matter progenitor cells
white spot syndrome virus orf390
white spotting locus
Whitlock-Witte long-term bone marrow cultures
WHO cytokine standardization
whole blood serum
whole body motion cells
whole cell phagocytosis
WHSDMEWWYLLG
wHTH
why can't scientists use precise language

WI-1
WI-26-VA4 factor
wide arbor cells
wide arbor interneurons
wide arbor neurons
wide-field amacrine cells
wide-field cells
wide-field ganglion cells
wide-field neurons
wide dynamic range neurons
WIF-1
WIF-1-like protein
WIFPWIQL
Williams factor
Williams-Fitzgerald-Flaujeac factor
Wilms tumor protein 1
Wilms tumor susceptibility gene
wing cells
winged cells of Langerhans
winged helix domain
winged helix-turn-helix fold
winged Huxley cells
wingful
wingless
wingless-type MMTV integration site family member 1
wingless-type MMTV integration site family member 2
wingless-type MMTV integration site family member 2b
wingless-type MMTV integration site family member 2b1
wingless-type MMTV integration site family member 2b2
wingless-type MMTV integration site family member 3
wingless-type MMTV integration site family member 3a
wingless-type MMTV integration site family member 4
wingless-type MMTV integration site family member 5a
wingless-type MMTV integration site family member 5b
wingless-type MMTV integration site family member 6
wingless-type MMTV integration site family member 7a
wingless-type MMTV integration site family member 7b
wingless-type MMTV integration site family member 7c
wingless-type MMTV integration site family member 8
wingless-type MMTV integration site family member 8a
wingless-type MMTV integration site family member 8b
wingless-type MMTV integration site family member 8c
wingless-type MMTV integration site family member 9a
wingless-type MMTV integration site family member 10a
wingless-type MMTV integration site family member 10b
wingless-type MMTV integration site family member 11
wingless-type MMTV integration site family member 12
wingless-type MMTV integration site family member 13
wingless-type MMTV integration site family member 13a
wingless-type MMTV integration site family member 13b
wingless-type MMTV integration site family member 13c
wingless-type MMTV integration site family member 14
wingless-type MMTV integration site family member 15
wingless-type MMTV integration site family member 16
wingless-type MMTV integration site family member 16a
wingless-type MMTV integration site family member 16b
wingless-type MMTV integration site proteins
wings apart-like
winner cells
Wisconsin-1
Wise
WISH
Wishful thinking
WISP-1
WISP-1 delta ex3-4
WISP-1v
WISP-1vL
WISP-1vx
WISP-2
WISP-3
WISP-3vL
WISP-1(221-238)
WISP-2(199-216)
WISP-3(232-249)
Wispostatin-1
wispostatin-2
wispostatin-3
Wit
with-no-lysine kinase 3

WJ-MSCs

WKGGNASGE
WKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTA
WKYMVm
WKYMVM

WLAHK
WLEEEEEAYGWMDFamide
WLGSALKIGAKLLPSVVGLFKKKKQ
WLGSALKIGAKLLPSVVGLFQKKKK
WLNALLHHGLNCAKGVLA
W locus
WLRRIGKGVKIIGGAALDHLamide
WLS
WLSEAGPVVTVRALRGTGSW

WMDF
WM neurons
WMPCs

WNK3
WNK lysine deficient protein kinase 3
WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK
WNPFKKIANRNCYPKTTCETAGGKKTCKDFSCCQIVLFGKKTRAKCTVVTS
WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNYamide
Wnt-1
Wnt-1 induced secreted protein-1
Wnt-1 induced secreted protein-2
Wnt-1 induced secreted protein-3
Wnt1-inducible signaling pathway protein-1
Wnt1-inducible signaling pathway protein-2
Wnt1-inducible signaling pathway protein-3
Wnt-2
Wnt-2b
Wnt-2b1
Wnt-2b2
Wnt-3
Wnt-3a
Wnt-4
Wnt-5a
Wnt-5a(317-322)
Wnt-5b
Wnt-6
Wnt-7a
Wnt-7b
Wnt-7c
Wnt-8
Wnt-8a
Wnt-8b
Wnt-8c
Wnt-9a
Wnt-9b
Wnt-10a
Wnt-10b
Wnt-11
Wnt-11-R
Wnt-11-Related gene
Wnt-12
Wnt-13
Wnt-13a
Wnt-13b
Wnt-13c
Wnt-14
Wnt-14b
Wnt-15
Wnt-16
Wnt-16a
Wnt-16b
Wnt/beta-catenin pathway
wntD
Wnt family
Wnt family member 1
Wnt family member 2
Wnt family member 2b
Wnt family member 2b1
Wnt family member 2b2
Wnt family member 3
Wnt family member 3a
Wnt family member 4
Wnt family member 5a
Wnt family member 5b
Wnt family member 6
Wnt family member 7a
Wnt family member 7b
Wnt family member 7c
Wnt family member 8
Wnt family member 8a
Wnt family member 8b
Wnt family member 8c
Wnt family member 9a
Wnt family member 9b
Wnt family member 10a
Wnt family member 10b
Wnt family member 11
Wnt family member 12
Wnt family member 13
Wnt family member 13a
Wnt family member 13b
Wnt family member 13c
Wnt family member 14
Wnt family member 14b
Wnt family member 15
Wnt family member 16
Wnt family member 16a
Wnt family member 16b
wnt inhibitor of dorsal
Wnt-inhibitory factor-1
Wntless
Wnt modulator in surface ectoderm
Wnt signaling

Words through the French Press Award
workshop cluster 6
workshop cluster 10
worm AIF homolog 1
Wound healing
Wound healing formula
wound healing macrophages
wounding assay
Wound migration assay
WOX1

WP1130
W peptide
wPGRP
WPLVIRTVIAGYNLYRAIKKKamide

WQVLPNAVPAK

Wr(a)
Wrapping glia
Wr(b)
wreath cells
W rescued by epo
Wright antigen
Wright blood group antigen
wrinkled
Writing a scientific publication
WRRRYRRWRRRRRWRRRPRRamide
WRS
WRW4
WRWWWW

WS2E
WS4
WS4C
W-sash
WSB-1
WSC domain
WSGPGVWGASVK
W-sh
WSKMDQLA
WSKMDQLAKELTAE
wsl-1
WsRC-Ws/Ws rats
WSSV449
WSSV orf390
wst
WST-1
wstd
Ws/Ws rats
WSX-1
WSXWS motif

WT1
WT1-interacting protein
WT1-pTj peptide
WT1(349-375)
WT-pHLIP
WTRCSSSCGRGVSVRSR
wts

Wu antigen
Wu blood group antigen
WUCAM
Wuchereria bancrofti macrophage migration inhibitory factor
Wulfsberg antigen

WW45
Wwamides
WW domain
WW domain-containing oxidoreductase
WW domain-containing oxidoreductase 1
WW domain containing protein 45 kDa
WWE domain
WWOX
WWSYVRRWRSRamide
W/Wv mice

WYKHVASPRYHTVGRAAGLLMGL
WYKHVASPRYHTVGRAAGLLMGLRRSPYLW
WYKPAAGHSSYSVGRAAGLLSGL
WYLGLDKEGQVMKG
WYMAFTRKGRPRKG
WYPAAP
WYVALKRTGQYKLG
WYVALNKRGKAKRG
WYVGFTKKGRPRKG
WYVSVNGKGRPRRG



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.