Wnt-5a(317-322) |
Wnt-6 |
ISDYSIRMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
||
[Wnt family member 5b; wingless-type MMTV integration site family member 5b] Wnt-5b is one member of the so-called Wnt family of proteins (Nusse et al, 1991), identified by Gavin et al (1990) by virtue of sequence homology to Wnt-1. The human gene has been identified by Saitoh and Katoh (2001). The Wnt-5b protein shares 80 % sequence identity with Wnt-5a. Saitoh and Katoh (2001) have reported moderate levels of Wnt-5b expression in adult prostate and fetal brain and low levels in fetal lung, kidney, adult liver, ovary, and small intestine. The gene is expressed also in gastric cancer and teratocarcinoma cell lines. Saitoh and Katoh (2002) have reported that upregulation of Wnt-5b in several types of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base