WKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTA |
WKYMVM |
HSPD1 |
||
This synthetic peptide (Trp-Lys-Tyr-Val-D-Met) (also referred to as W peptide) has been selected from random peptide libraries on the basis of its ability to stimulate phosphoinositide hydrolysis in lymphocytes (Baek et al, 1996; Seo et al, 1997). This peptide cannot be classified as one of the cytokines or growth factors due to its small molecular weight (see also: regulatory peptide factors). WKYMVm activates receptors FPR1, FPRL1, and FPRL2 in a calcium mobilization assay (Christophe et al, 2001). WKYMVm peptide stimulates phosphoinositide hydrolysis in several hematopoietic cell lines (U937
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |