COPE Advertising options



Previous Next
Search COPE:
 


- Y -

Select one of the following:


Y1/82A

Y2/131

Y16

Y73 avian sarcoma virus oncogene

Y134R
Y136

YAAWPASGAWTGTAPCSAGT
Yaba-like disease virus 7L protein
Yaba-like disease virus 134R protein
Yaba-like disease virus 145R protein
Yaba-like disease virus IL10
Yaba-like disease virus Y136 protein
Yaba monkey tumor virus 2L protein
Yaba monkey tumor virus TNF binding protein
YAC-1
yadA
YadA(ent)
YadA(pstb)
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
YAFDVVGamide
YAFEVVGamide
YAFGYPSamide
YAKPVA
Yam 1B immunoregulatory factor
YAMA
Yamaguchi sarcoma virus
Yamanaka factors
Yamanaka cocktail
Y-antigen
YAPC
YARKARRQARR
YARAAARQARA
YARAARRAARR
YARS
YARS2
YASGR
YAVD
YAVD-AFC
YAVD-AMC
YAVD-CHO

Y cells
YCA1
YCA1p
YCNIHQVCHYAQRNDRSYWL
YCNINEVCHYARRNDKSYWL

YDAKEANMEGIVT
Y-determinant
YDPEAASAPGSGNPCHEASAAQKENAGEDP

YEAF1
Yeast Caspase-1
yeast caspase-1 protein
Yeast metacaspase-1
yeasts
Yeast Sps1/Ste20-related Kinase 3
yellow adipocytes
yellow bone marrow
yellow marrow
yellowfin tuna GAPDH-related antimicrobial peptide
YER163c
yersinia adhesin A
yersinia outer protein 1
yersinia outer protein A
Yersinia outer protein J
Yersinia outer protein P
Yersinia pseudotuberculosis invasin
yes
YEYAY

YFGAP
YFLFRPRN
YFPGQFAFS
YFPIPIamide
YFSPWGamide
YFVALNKDGTPRDG

YGARPGVGVGGIP
YGFGG
YGFGNA
YGGFF
YGGFI
YGGFL
YGGFLRFamide
YGGFLRKYP
YGGFLRKYPK
YGGFLRRI
YGGFLRRIRPKLK
YGGFLRRIRPKLKWDNQ
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
YGGFLRRQFKVVT
YGGFLRRQFKVVTRSQQDPNPNAYYGGLFNV
YGGFM
YGGFMD
YGGFMGY
YGGFMI
YGGFMKF
YGGFMNGF
YGGFMR
YGGFMRF
YGGFMRFamide
YGGFMRGL
YGGFMRGY
YGGFMRI
YGGFMRSL
YGGFMRRVGRPEWWMDYQKRYG
YGGFMRSV
YGGFMRY
YGGFMS
YGGFMTSEKSQTPLVT
YGGFMTSEKSQTPLVTL
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
YGGW
YGGWL
YGL
YGLF
YGQVPMCDAGEQCAVRKGARI
YGRKKRRQRRR
YGWMDFamide

Y-hapten
YHRLRDLLLIVTRIVELLGRR

YIFNL
YIGSLARAGGLMTY
YIGSR
YIIDVPPRCPPGSKFIKNRCRVIVPamide
YIIDVPPRCPPGSKFVHKRCRVIVPamide
YIINVPPRCPPGSKFVKNKCRVIVPamide
YIPIQYVLSR
yippee-like 3
YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
YITCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF

Yk(a)
YKGANKKGLSKGCFGLKLDRIGSMSGLGC
YKL39
YKL40
YKL40/Brp39
YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
YKVPQL

YLDV 7L protein
YLDV IL10
YLGSGY
Y-linked ribosomal protein S4
YLKGCWTKSYPPKPCFSR
Y-like primate retinal ganglion cells
YLLF
YLYEIAR

Ym1
Ym2
Ym1/2
YM643
YMFHLMDamide
YMGWMDF
Y-ML-1B
YMP
YMTV-2L

Y Neuropeptide
YNWNSFamide
YNWNSFGLRFamide

Yolk protein 3
yolk sac hematopoietic stem cells
yop1
yopA
YopJ
YopP
York blood group antigen
YOU
young age-related urinary glycoprotein
young age-related urinary glycoprotein 1
young age-related urinary glycoprotein 2
young age-related urinary glycoprotein 3

Y-P30
Yp3
YPC
YPCKLNLKLGKVPFH
Ypel3
YPFFamide
YPFPamide
YPFPG
YPFPGP
YPFPGPI
YPFPGPIPN
YPFPGPIPNS
YPFPGPIPNSL
YPFT
YPFTI
YPFVEPI
YPFVEPIP
YPFVEPIPYGF
YPFVV
YPFVVN
YPFVVNA
YPGPQAKEDSEGPSQGPASREK
YPHIDSLGHWRR
YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYamide
YPILPEYLQ
YPISL
YPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDP
YPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
YPKGamide
YPLDL
YPLDLF
YPLGamide
YPQEHRFSFGLamide
YPQPQPF
YPSFQ
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRYamide
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYamide
YPSY
YPSYGLN
YPVEP
YPVEPF
YPVEPFTE
YPVTQPLAPVHNPIS
YPWFamide
YPWGamide
YPWT
YPWTQ
YPWTQRF
YPYY

YQEPVL
YQEPVLGPVR
YQEPVLGPVRGPFPI
YQEPVLGPVRGPFPIIV
YQPPSTNKNTKSQRRKGSTFEEHK
YQQRPVA
YQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSF

Y RNA-derived small RNAs
Y RNAs
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

YSA peptide
YSAYPDSVPMMSK
YS-HSC
YSK3
YSKFNFGLamide
YSLKKTSMKIIPFTRL
YSMKKTTMKIIPFNRLTIG
YSPLDFIGSRamide
YS-PPB
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
YsRNAs
YSY peptide

YT
YT1 antigen
YT2 antigen
YT4
YT16
Yta antigen
Ytb antigen
Yt blood group
YTH 53.1
YT-INDY
YTIWMPENPRPGTPCDIFTNSRGKRASNG
YTPKT
YTRDLVYKDPARPKIQKTCTF
YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
YTTGKLPYGYGPGG
Y-type cells

Yuk(a)
Yuk alloantigen
Yuk(b)
Yus blood group antigen
Yussef antigen
Yuti Chernajovsky

YVAD
YVAD-AFC
YVAD-AMC
YVADase
YVAD-CHO
YVAD-CMK
YVAD-fmk
YVAD-pNA
YVL
YVMGHFRWDRF
YVMGHFRWDRFG
YVPFP
YVPFPPF
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
YVRL
YVSCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF

YWHA1
YWHAA
YWHAB
YWHAE
YWHAG
YWHAH
YWHAQ
YWHAS
YWHAZ

YXFGLamides
YXXL motif

YY1 and E4TF1/hGABP-associated factor-1
YYGGGYKYKHWGCR
YYQQKPVA
YYVALNKDGSPREG
YYVALNKDGTPREG



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.