YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
YSAYPDSVPMMSK |
Gallin-1 |
||
This targeting peptide, YSAYPDSVPMMSK, has been identified by phage display library screening as a high affinity peptide ligand for the EphA2 transmembrane receptor tyrosine kinase. The peptide target the ligand-binding domain of EphA2 and competes with ephrin ligands for binding. (Koolpe et al, 2002).
Guo et al (2015) have used stealth liposomes functionalized with the YSA peptide and loaded with the cancer drug doxorubicin to target tumor neovasculature and some kinds of tumor cells that highly express EphA2. Peptide-functionalized liposomes show significant specificity to both EphA2-overexpressing tumor cells (MDA-MB-231) and human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |