YQPPSTNKNTKSQRRKGSTFEEHK |
YQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSF |
double-positive T-cells |
||
[Tyr-Gln-Gln-Arg-Pro-Val-Ala] This peptide is a hydrolysis product of caseins in ovine milk and is derived from casein-kappa (Gómez-Ruiz et al, 2007). The peptide acts as a potent inhibitor for ACE [angiotensin-converting enzyme; angiotensin-1 converting enzyme].
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |