YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
YVSCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF |
Brichos domain containing 1 |
||
This peptide corresponds to a bioactive fragment of laminin-gamma-1. See: laminin-gamma-1(139-150)
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |