COPE Advertising options



Previous Next
Search COPE:
 


- Q -

Select one of the following:


q

Q1 peptide

Q2/3L

Q6

Q7YRI0(9-28)

Qa
QA79 membrane protein
QAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLG
QAEQLPPEGSYAGSDELEGMA
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKKFNLNL
QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL
QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL
QAIIHNEKVQAHGKKVL
QARLLLSGIVQQQNNLLRAI
QARS
QATVGDVNTDRPGLLDLK
QAWFIENEEQEYVQTVK

q blast cells
QBp-1

QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
QCRRLCYKQRCVTYCRGR

QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFamide
QDEL
QDLQTLCCTDGCSMTDLSALC
QDRPKKPGLCPPRPQKPCVKECKNDWSCPGQQKCCNYGCIDECRDPIFVN

QEANVAHHYCGRHLANTLADLCWDTSVE
QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKS
QEDCELCINVACTGC
QEECELCINMACTGY
QEGAPPQQSARRDRMPCRNFFWKTFSSCK
QELLLNPTHQYPVTQPLAPVHNPISV
QEQEELENYIEHVLLHRP
QEQLERALNSS

qFAF
QFDEPEATGGVPILKY
QFHVERPDRTVDFGNGGFSAQRF
QFHVERPGRTVDVGNGGFYIQRG
QFLQKSLAAAAamide

QGDGEDPCQIVRCSYGANCIAYGDTAICECPFGYSGIRCQDPS
QGGDFTRHNGTGGKSIYGEKFEDENFILKH
QGGLLGKVSNLANDALGILPI
QGKRPWIL
QGLIAFPRVamide
QGLIPFPRVamide
QGLISFPRVamide
QGMIGTLTSKRIKQamide
QGPWLEEEEEAYGWMDFamide
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR
QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR
QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
QGVRNHVTCRIYGGFCVPIRCPGRTRQIGTCFGRPVKCCRRW
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR

QHNPR
QHREDGS
QHWSYGWLPG

QIGLF
QIKMFKGPEKDIEFIYT
QIPMLRLamide
QIYQFTDKDKDNVAPRSKISPQGY

QK
QK1
QKI
QKI-5
QKI-6
QKI-7
qk(e5)
qki-a
QKIAEKFSGTRRG
QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK
QKKGFCAGYCSYSCAKTDEWTFHQTCGKMYCCIPPPKKG
QKNDTAFSCHFFEIYLSNCFNKEKYIKNYLQIM
qk(v)

QL17 peptide
QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFamide
QLHVARPDRTVTIGNGGVYIQRS
QLISHQQYGHQEVTRFDFTTTSTST
QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY
QLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIamide
QLQGKQVSGEVVQKVLQELIQSVAKP
QLQSNGEPAYRVRTPRLamide
QLSNGNRTLT
QLSN peptide
QLWAVGSFM
QLWAVGSLM
QLYENKPRRPYIL
QLYSALANKCCHVGCTKRSLARFC

QMIVIELGTNPLKSSGIENGAFQGMK

QNLIPFPRVamide

QPFSLERW
QPGYSHSFVamide
QPK
QPKRSCRGHCSRTCGKGEREEHTEDCGGMHCCLTHRKR
QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLamide
QPPGGSKVILF
QPQFTPRL
QPRS
QPSFGHSFVamide
QPSFTHAFVamide
QPSHISKYILRWRPKNSVGRWKEAT
QPSKDAFIGLMamide
QPSYGHSFVamide
QPSYTHAFVamide
QPT22
QPTRRPRPGTGPGRRPRPRPRP
QPVVPVEADPMEQRAEEAP
QPVVPVEAVDPMEQRAEEAPRRQL
QPWGTCSESCGKGTQTRAR
QPWSQCSATCGDGVRERRR

QQETAAAETETRTHTLTRVNLESPGPERVW
QQDYTGWMDFamide
QQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIamide
QQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMamide
QQPQAVHTYCGRHLARTLADLCWEAGVD
QQPQRVHTYCGRHLARTLADLCWEAGVD
QQRLGNQWAVGHLM
QQVLSTGRVQGYDGFFVISVEQYPELSDSANNIHFMRQSEMamide
QQWAVGHFM

QR1
QRFP
QRFP26
QRFP43
QRFPR
QRFP-r1
QRFP-r2
QRFP receptor
QRFSR
QRFTTMPFLFCNVNDVCNF
QRLFQV
QRLFQVKGRR
QRPRLSHKGPMPF
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
QRPYTQPLIYYPPPPTPPRIYRA
QRS
QRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR

QSCN6
QSCN6L1
QSERFEQQMQGQDFSHDERFLSQAA
QSHLSLCRWCCNCCRSNKGC
QSOX1
QSOX2
QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCRR

Q teloblasts
QTFQYSRGWTNamide
QTLIPMPRL/Iamide

Qua1 domain
Qua2 domain
quail chorioallantoic membrane assay
quail endothelial kinase-1
quail endothelial kinase-2
quail FAF-1
Quaking
quaking-5
quaking-6
quaking-7
quaking-a
quaking(viable)
Quality control of cytokines
Quantification of cytokine receptor data
Quantification of cytokines
Quantitative analyses of hematopoietic stem cells
queen brain-selective protein-1
Quek-1
Quek-2
quelling
Quercetin
quiescence-inducible genes
quiescence-specific protein
quiescent cells
quiescin Q6
Quiescin Q6-like protein 1
quiescin Q6 sulfhydryl oxidase 1
quiescin Q6 sulfhydryl oxidase 2
quiescin Q10
Quiescin sulfhydryl oxidase 1
quiescins
Quinoline-Val-Asp-Difluorophenoxymethylketone
Quinone reductases 1
Quotations

Q-Val-Asp-OPH
qVD
Q-VD-OPh
QVDRLGGFQVHGW
QVDSLGGFQVHGW
QVLKYCPKIGYCSSKCSKAEVWAYSPDCKVHCCVPANQKW
QVRKYCPKVGYCSSKCSKADVWSLSSDCKFYCCLPPGWK
QVTSTEV
QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW

QWGRRCCGWGPGRRYCRRWC
QWGRRCCGWGPGRRYCVRWC
QWGYGGYamide

QYDRVAELDQLLHY
QYDRVAQLDQLLHY
QYGRRCCNWGPGRRYCKRWC
QYMSPCHFKICNMamide
QYRHRCCAWGPGRKYCKRWC
QYYYGASPYAYSGGYYDSPYSY



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.