QRPYTQPLIYYPPPPTPPRIYRA |
QRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR |
PABA peptide hydrolase |
||
see: glutaminyl-tRNA synthetase.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |