qki-a |
QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK |
urinary protein 1 |
||
This antimicrobial peptide corresponds to a bioactive fragment of chromogranin B. See: Granins.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |