COPE Media Kit


Cope Home
Previous entry:
TRCPDGQFCPVACCLDPGGASYSCCRPLLD
Next entry:
TRDL-1-alpha
Random entry:
5-Amino-[(N-2,5-dihydroxybenzyl)-N′-2-hydroxybenzyl]salicylic acid
Search COPE:

TRDL-1

[TNF-related death ligand-1] TRDL-1-alpha has been identified through EST database searching, using TNF-alpha protein as the search query. The protein is identical in sequence to APRIL. TRDL-1-beta and TRDL-1-gamma are splice variants that differ from TRDL-1-alpha by the deletion of two small regions within the protein coding region (Kelly et al, 2000).

In vitro binding experiments demonstrate that TRDL-1-alpha coprecipitates FAS and HVEM, suggesting that TRDL-1-alpha is an alternate ligand for these receptors (Kelly et al, 2000).

In the nomenclature of CD antigens ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

Entry completed



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=50884