Oxyopinin 4a |
oxyphil cells |
NBK |
||
A family of 5 cationic amphipathic peptides with antimicrobial, hemolytic, and insecticidal activity isolated from the crude venom of the wolf spider Oxyopes kitabensis (Corzo et al, 2002).
Oxyopinin 1 (M-oxotoxin-Ot1a) (FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ) shows extended sequence similarity to one of the ponericins, the ant insecticidal peptide ponericin-L2, and to the frog antimicrobial peptide dermaseptin.
Oxyopinin 2a (M-oxotoxin-Ot2a) (GKFSVFGKILRSIAKVFKGVGKVRKQFKTASDLDKNQ),
Oxyopinin 2b (M-oxotoxin-Ot2b
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |