Lebein-2 |
lebocin |
gaegurin-2 |
||
This protein (41 amino acids; CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPSYPG) has been isolated from the venom of the Tunisian snake Macrovipera lebetina. The protein contains an integrin binding domain (KTS instead of RGD) and shows high homology with obtustatin and viperistatin. Lebestatin interacts specifically with the integrin-alpha-1 / integrin-beta-1, prevents binding to collagen type-1 and collagen type-4, and inhibits cell adhesion and migration. Lebestatin also blocks adhesion and migration of endothelial cells in vitro and blocks angiogenesis in vivo in a chicken chorioallantoic membrane assay (Olfa et al, 2005).
See also: Angiogenesis Dictionary
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |