COPE Media Kit

Cope Home
Previous entry:
Next entry:
Random entry:
Asparaginyl-tRNA synthetase
Search COPE:


This protein (41 amino acids; CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPSYPG) has been isolated from the venom of the Tunisian snake Macrovipera lebetina. The protein contains an integrin binding domain (KTS instead of RGD) and shows high homology with obtustatin and viperistatin. Lebestatin interacts specifically with the integrin-alpha-1 / integrin-beta-1, prevents binding to collagen type-1 and collagen type-4, and inhibits cell adhesion and migration. Lebestatin also blocks adhesion and migration of endothelial cells in vitro and blocks angiogenesis in vivo in a chicken chorioallantoic membrane assay (Olfa et al, 2005).

See also: Angiogenesis Dictionary ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=29958