COPE Media Kit


Cope Home
Previous entry:
OB-RS
Next entry:
O-[Chloroacetylcarbamoyl]-Fumagillol
Random entry:
chemokine (C-C motif) ligand 9
Search COPE:

Obtustatin

Obtustatin (CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG) is a disintegrin isolated from the venom of the Vipera lebetina obtusa viper. The protein does not contain the classical RGD sequence characteristic of other integrins.

Obtustatin is a potent and selective inhibitor of the binding of integrin-alpha-1 / integrin-beta-1 to collagen type 4. For a more potent related factor see also: Viperistatin.

Obtustatin has been shown to be a potent inhibitor of angiogenesis in vivo in the chicken chorioallantoic membrane assay and also blocks neovascularization of in transplanted Lewis lung tumors transplanted into nude mice (Marcinkiewicz et al, 2003).

See also: ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=37740