BCL peptide |
BCLrambo-beta |
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG |
||
This protein is a widely expressed member of the BCL2 family of proteins. The protein contains conserved BH1, BH2, BH3, and BH4 BCL2 homology domains. The protein contains a unique 250 amino acid insertion in front of the C-terminal membrane anchor region that is not found in BCL2. The approved gene symbol is BCL2L13 [BCL2-like-13].
BCLrambo does not interact with BCL2, BCLxL, BCLw, A1, MCL1, E1B 19 kDa protein, and BHRF-1 (anti-apoptotic members of the BCL2 family of proteins) or BAX,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |