glutamine-tryptophan-isoleucine-2 |
Glutamoptosis |
DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE |
||
abbr. and approved gene symbol: QARS; abbr. also: QRS, GlnRS. The enzyme (EC6.1.1.18 in the enzyme nomenclature catalogue) is known also as Glutamine-tRNA ligase. The human gene has cloned by Lamour et al (1994). Note that glutaminyl-tRNA synthetase and prolyl-tRNA synthetase are both on one polypeptide chain encoded by the human EPRS gene (see: glutamyl-prolyl-tRNA synthetase).
Role as moonlighting protein
Apart from its role as an aminoacyl-tRNA synthetase
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |