MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK |
MPECs |
Placental prolactin-like protein O |
||
[membrane protein E16] A partial cDNA encoding this protein has been cloned by Gaugitsch et al (1992) who reported also that the protein is expressed in activated lymphocytes. Maglott et al (1994) have reported that the E16 gene is expressed abundantly in many adult tissues.
Mastroberardino et al (1998) have identified the human MPE16 (E16) protein as the light chain of the cell surface glycoprotein 4F2. They have shown also that the heterodimeric complex between the heavy chain and the light chain mediates L-type amino acid transport. The rat cDNA for MPE16 has been cloned by Kanai et al (1998), who referred to the encoded protein as LAT1 [
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |