LAI |
LAIR2 |
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI |
||
[leukocyte-associated Ig-like receptor 1] In the nomenclature of CD antigens this protein has been given the designation CD305 (Warren, 2005).
LAIR1 has been identified by Meyaard et al (1997); overview: Meyaard, 2008). LAIR1 is a 32 kDa transmembrane glycoprotein with a single extracellular immunoglobulin variable domain and 2 ITIM motifs in its cytoplasmic tail that mediate inhibitory functions through the interaction with phosphatases Shp1, Shp2, and C-terminal Src kinase (Meyaard et al, 1997; Verbrugge et al, 2006, 2003). Xu et al (2000) have identified four LAIR1 isoforms/ At least one of them lacks most of the intracellular segment and also the ITIM motifs.
LAIR1 is expressed in multiple peripheral blood
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |