COPE Media Kit


Cope Home
Previous entry:
LAI
Next entry:
LAIR2
Random entry:
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
Search COPE:

LAIR1

[leukocyte-associated Ig-like receptor 1] In the nomenclature of CD antigens this protein has been given the designation CD305 (Warren, 2005).

LAIR1 has been identified by Meyaard et al (1997); overview: Meyaard, 2008). LAIR1 is a 32 kDa transmembrane glycoprotein with a single extracellular immunoglobulin variable domain and 2 ITIM motifs in its cytoplasmic tail that mediate inhibitory functions through the interaction with phosphatases Shp1, Shp2, and C-terminal Src kinase (Meyaard et al, 1997; Verbrugge et al, 2006, 2003). Xu et al (2000) have identified four LAIR1 isoforms/ At least one of them lacks most of the intracellular segment and also the ITIM motifs.

LAIR1 is expressed in multiple peripheral blood ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2018



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=29530