GRPNPVNTKPTPYPRL |
GRPPGFSPFRID |
corticotrophs |
||
[glicentin-related pancreatic polypeptide] This peptide hormone (RSLQDTEEKSRSFSASQADPLSDPDQMNED) is encoded by the glucagon gene and comprises the N-terminal residues 1-30 of glicentin. It corresponds to PG(1-30) [proglucagon(1-30)] (see also: Holst, 1997). It has been isolated originally from porcine pancreas (Thim and Moody, 1981, 1982). The hormone is released from the precursor protein by protelytic cleavage (Holst, 1997). The protein is expressed in both intestinal L cells and pancreatic or gastric A-cells of some mammals (dog, man, guinea pig) (Solcia et al, 1985). The hormone
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |