DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW |
DFCP1 |
Oligosaccharyl transferase 48 kDa subunit |
||
[dedifferentiated fat cells] These cells are mature lipid-filled adipocytes that have lost the fat and have reverted to a more primitive, proliferative phenotype under specific cell culture conditions (Matsumoto et al, 2008; Nobusue et al, 2008; Fernyhough et al, 2008). The cells possess the same morphological (fibroblast like) appearance as the stem cells from the stromal fraction of adipose tissues. DFAT-cells have lost markers specific for adipocytes but have gained multi-potent characteristics and are able to differentiate into multiple mesenchymal cell lineages under appropriate culture conditions (Matsumoto et al, 2008; Nobusue et al, 2008). DFAT-cells differentiate into adipocytes,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |