BIK-like killer protein |
bile duct cells |
GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC |
||
The designation bikunin has been proposed by Gebhard et al (1990). Bikunin is the smallest of three subunits of ITI (Inter-alpha-trypsin inhibitor). As the light chain of ITI [Inter-alpha-trypsin inhibitor], Bikunin has been referred to also as ITI-LC [Inter-alpha-trypsin inhibitor light chain]. Bikunin has been identified independently as UAP [Uronic-Acid-rich Protein]. The rat counterpart of Bikunin is most likely Trypstatin. Bikunin has been shown to be identical with ECGF-2b (endothelial cell growth factor-2b). Placental Bikunin is identical with HAI-2 [HGF activator inhibitor type 1].
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |