bZIP domain |
BZLF2 |
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL |
||
The name is an acronym for BamHI Z fragment leftward open reading frame 1 (Baer et al, 1984). This gene is encoded in the genome of Epstein-Barr virus (Epstein-Barr virus BZLF1 protein). The gene, called also EB1 (Chevallier-Greco A et al, 1986; Urier et al, 1989), belongs to the class of immediate-early response genes and encodes a gene product known also as ZEBRA or Zta.
The expression of BZLF1 regulates the switch from latent infection to virus replication in EBV-infected B-cells and thus is a key
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |