veiled cells |
VEJAM |
HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP |
||
symbol vn (gene: CG10491). Schnepp et al (1996) have reported that Drosophila melanogaster Vein encodes a candidate EGF receptor ligand with similarity to the neuregulins and that expression of vein is spatially restricted. Decapentaplegic and wingless have been shown to upregulate Vein expression in the midgut mesoderm (Szuts et al, 1998). The vein locus has been defined also as ddd [defective dorsal discs] characterized by a greatly reduced size or absence of the dorsal discs (wing, haltere, and humeral) while the ventral discs (leg) are unaffected (Simcox et al, 1987; García-Bellido et al, 1994)
An interplay between Vein and another
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |