Vcsda1 |
VCVLAHHFGKEETPPVQAAYQKVVAGVANALAHKYH |
Matrixins |
||
[viral CSF1 binding protein] Name given in newer publications to BARF1. See also: viroceptor.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |