myeloid cell nuclear differentiation antigen |
myeloid cell-specific leucine-rich glycoprotein |
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
[myeloid lineage, myeloid cell]
also: myeloid hematopoietic cells, myelohematopoietic cells. This is a collective term for cell types that belong to one of the two large lineages of blood cells developing from primitive totipotent hematopoietic stem cells (see also: hematopoietic stem cells, Hematopoiesis). Myeloid cells are derived from myeloid stem cells and include erythrocytes, thrombocytes, neutrophils, monocytes and macrophages, eosinophils, basophils, and mast cells. These cell types
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |