Hormones Dictionary |
horn cells |
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC |
||
[hormones/neuropeptide MiniCOPE dictionary]
This list of hormones is one of the MiniCOPE Dictionaries grouping contents of the COPE encyclopedia by topics. This list partially overlaps with entries for regulatory peptide factors, which comprise lower molecular weight peptides and oligopeptides. The list also contains various neuropeptides that are not classified as hormones for the simple reason that they are not produced by cells organized in glands but are being referred to as neuromodulators rather than neurotransmitters. This subdictionary also includes some proteins that play key roles in regulating hormone expression as well as hormone/peptide receptors.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |