Vejovina |
Velate astrocytes |
Neoendorphins |
||
also: Vejovina. Vejovine (GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS) is an antimicrobial peptide isolated from the venom of the Mexican scorpion Vaejovis mexicanus. Vejovine inhibits growth of clinical isolates of Gram-negative multidrug resistant (Pseudomonas aeruginosa, Klebsiella pneumoniae, Escherichia coli, Enterobacter cloacae and Acinetobacter baumanii) causing nosocomial infections. This peptide is hemolytic for human erythrocytes (Hernández-Aponte et al, 2011).
Sánchez-Vásquez et al (2013) have synthesized a synthetic peptide combining sequences of vejovine and hadrurin. The synthetic peptide shows improved activity against
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |