TP XS52.1 peptide |
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY |
sialoglycoprotein alpha |
||
The monoclonal antibody of this name (Reinherz et al, 1982) recognizes an antigen in a minority (less than 7 %) of thymocytes. It reacts with 70-85 % of CD4(+) lymphocytes, but also stains 50 % of T-cells within the CD4(-) (CD8(+) cytotoxic/suppressor subset. The antigen defined by TQ1 is not restricted in its expression to T-cells; it defines a fraction of normal B-cells and null lymphocytes as well as non-T-cell lines.
Camerini et al (1989) have shown that TQ-1 is the human equivalent of the lymph node homing receptor MEL-14. Tedder et al (1990) have reported that the human leukocyte adhesion molecule
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |