LU2 |
LU19 |
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
||
see: Lutheran blood group antigen. In the nomenclature of CD antigens this protein has been given the designation CD239.
For additional information on CD antigens see also: CD antigens Dictionary.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |