HPA-4b |
HPA-5a |
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
||
[human platelet antigen-5] In the nomenclature for platelet antigens (Metcalfe et al, 2003) this is the designation for the platelet glycoprotein GPIa. In the nomenclature of CD antigens the proteins has been given the designation CD49b. HPA-5a [human platelet antigen-5a] (see: Br(b), Zav(b)) and HPA-5b [human platelet antigen-5b] (see: Br(a), Zav(a)) are alleles of the same protein.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |