Gsdma3 |
GSDMB |
YPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDP |
||
(approved gene symbol) [gasdermin A] GSDMA is a member of a gene family and is expressed primarily in the epithelial cells of the skin, upper gastrointestinal tract, and the lung (Tamura et al, 2007). The mouse has three orthologs termed Gsdma1, Gsdma2, Gsdma3.
The GSDMA gene, called GSDM1 [gasdermin 1], which is one of the gasdermins, has been cloned by Saeki et al (2000) who reported that the protein is expressed predominantly in the upper gastrointestinal tract but suppressed significantly in human gastric cancer cells. Saeki et al (2007) have reported that GSDMA is a component of TGF-beta
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |