GPR54 |
GPR65 |
VQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
||
[G-protein-coupled receptor-55] The gene for this G-protein-coupled receptor has been cloned by Sawzdargo et al (1999). Oka et al (2007) have reported that lysophosphatidylinositol induces rapid phosphorylation of ERK in cells expressing human GPR55, suggesting that GPR55 is a specific and functional lysophosphatidylinositol receptor. Okuno and Yokomizo (2011) have suggested that 2-arachidonolyl lysophosphatidylinositol is the most likely natural ligand of GPR55.
Lauckner et al (2008) have reported some cannabinoid agonists also activate GPR55 and increase intracellular calcium in mouse large dorsal root ganglion neurons
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |