GC26 |
GC109 |
A1AT |
||
This peptide (Jin H et al, 2011), GFQWVTGDNNTSYSRWARLDLNGAPLCGPLC, is derived from the conserved C-type lectin-like domain of thrombomodulin, a single-transmembrane glycoprotein receptor for thrombin. Jin et al (2011) have reported anti-inflammatory effects of GC31 in uveitis induced by endotoxin, which is characterized by a reduction of leukocyte counts, protein concentration, TNF-alpha and MCP-1 levels in aqueous humor. GC31 suppresses TNF-alpha and IL6 expressions in macrophages stimulated with lipopolysaccharide and interrupted LPS-induced activation of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |