FMRFa |
FMRFamide A |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
||
[Phe-Met-Arg-Pheamide] FMRFamide, also: FMRFa, is a short neuropeptide isolated originally as a cardioexcitatory peptide from the clam Marocallistu nimbosa (Price and Greenberg, 1977). FMRFamide-related peptides (abbr. FaRPs), called also extended FMRFamides, constitute a very large ubiquitous family of neuropeptides with several hundred members that have the carboxyterminal sequence Phe-Met-Arg-Pheamide and contain additional unique but widely diverse N-terminal amino acids (Dockray, 2004; Fukusumi et al, 2006; Walker et al, 2009). Metastin (Kisspeptin-1) and GnIH [gonadotropin-inhibitory hormone] are members of the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |