caspase-8s |
Caspase-9-alpha |
GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME |
||
abbr. CASP9. This enzyme is a member of a family of evolutionarily conserved cysteine protease proteins known as caspases. Many of these enzymes are part of a proteolytic cascade that plays a central role in cell death by apoptosis. The full-length molecule has been termed Caspase-9-alpha.
This Caspase is identical with APAF-3 [Apoptosis protease activating factor-3], a factor identified in HeLa cell extracts as a protein factor that binds APAF-1 and that participates in the activation of Caspase-3 in vitro. The activity of caspase-9 is inhibited by XIAP (Srinivasula et al, 1998).
Izawa et al (1999) have described
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |