Bass hepcidin |
BAT-cells |
MLKLIFLHRLKRMRKRLKRKLRLWHRKRYK |
||
[HLA-B-associated transcript 3; B-associated transcript 3] This gene, located within human major histocompatibility complex, has been identified by Banerji et al (1990). The protein (110 kDa) contains an amino-terminal ubiquitin-like domain. Sequence comparisons show that BAT3 is identical with scythe. Another designation for scythe is BAG6 [BCL2-associated athanogene-6].
The rat ortholog, termed RLC34 by Wang and Liew (1994), is expressed predominantly in the germ cells of rodent testes. Ozaki et al (1993), have cloned the rat BAT3
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |