B10 cells |
B13 |
SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ |
||
An early response gene encoding a protein of 316 amino acids the transcription of which is rapidly and transiently stimulated by TNF-alpha in human umbilical vein endothelial cells (Wolf et al, 1992). The mouse gene has been described as EDP1 (Swift et al, 1998). The approved gene symbol for this protein is TNFAIP1 [tumor necrosis factor-alpha-induced protein 1; TNF-alpha-induced protein 1]. A databank synonym is endothelial TNF-alpha-induced protein 1.
The human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |