ATRN |
ATSKPSLKC |
GFGCPGDAYQCSEHCRALGGGRTGGYCAGPWYLGHPTCTCSF |
||
a 24 kDa zinc metalloproteinase, called also HT-d [hemorrhagic toxin d] isolated from western diamondback rattlesnake (Crotalus atrox) venom (Bjarnason and Fox, 1987). The amino acid sequence has been reported by Shannon et al (1989).
The enzyme efficiently degrades capillary basement membranes, extracellular matrix, and cell surface proteins to produce hemorrhage. It cleaves fibronectin, laminin, collagen-4, nidogen (entactin), and gelatins but not the interstitial collagen types I and III or type V collagen (Baramova et al, 1989; Shannon et al, 1989). von Willebrand factor is cleaved at dispersed sites (Serrano et al, 2007). The enzyme is an aggrecanase
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |