COPE Media Kit


Cope Home
Previous entry:
ATRN
Next entry:
ATSKPSLKC
Random entry:
GFGCPGDAYQCSEHCRALGGGRTGGYCAGPWYLGHPTCTCSF
Search COPE:

Atrolysin C

a 24 kDa zinc metalloproteinase, called also HT-d [hemorrhagic toxin d] isolated from western diamondback rattlesnake (Crotalus atrox) venom (Bjarnason and Fox, 1987). The amino acid sequence has been reported by Shannon et al (1989).

The enzyme efficiently degrades capillary basement membranes, extracellular matrix, and cell surface proteins to produce hemorrhage. It cleaves fibronectin, laminin, collagen-4, nidogen (entactin), and gelatins but not the interstitial collagen types I and III or type V collagen (Baramova et al, 1989; Shannon et al, 1989). von Willebrand factor is cleaved at dispersed sites (Serrano et al, 2007). The enzyme is an aggrecanase ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2008



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=4203