COPE Media Kit


Cope Home
Previous entry:
OBIF
Next entry:
o blast cells
Random entry:
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Search COPE:

obl

[obl/obl]

[oblivious] Obl mice are mutant mice with an N-ethyl-N-nitrosourea-induced nonsense mutation of CD36 (Hoebe et al, 2005).

These mice have a reduced response to specific TLR2 ligands, lipoteichoic acids and MALP-2 [macrophage activating lipoprotein-2], but respond normally to the synthetic lipopeptides, Pam3CSK4 and Pam2CSK4, demonstrating that some, but not all TLR2 ligands depend on CD36. These animals are also unable to clear Staphylococcus aureus and show higher mortality compared to C57BL/6 wild-type mice. They are also more prone to develop abscesses (Stuart et al, 2005).

For additional information on CD antigens ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=37725