Luteinizing hormone receptor mRNA-binding protein |
luteinizing hormone releasing hormone |
APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW |
||
abbr. LHRF. this is the same as LHRH [luteinizing hormone releasing hormone]. It is the same as gonadotropin releasing hormone 1. See: GNRH1, which is the approved gene symbol.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors. For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |