jelly belly |
Jerne B-cells |
Dendritic cell-specific ICAM-3-grabbing nonintegrin-2 |
||
The gene encoding this protein has been cloned from the genome of the Chinese Jerdons pit viper Trimeresurus jerdonii (Sanz et al, 2005). The protein (CTTGPCCRQCKLKPAGTTCWRTSVSSHYCTGRSCECPSYPG) contains a disintegrin domain with 80 % identity with that of obtustatin and viperistatin.
Jerdostatin is a potent and specific antagonist of the integrin integrin-alpha-1 / integrin-beta-1 (CD49a / CD29). Jerdostatin has been shown to inhibit binding of collagen type-4 to integrin-alpha-1 but not to other integrins (Juárez et al, 2010). Owing to its specificity of integrin binding it is expected to block angiogenesis in vivo (see also: Obtustatin).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |