COPE Media Kit


Cope Home
Previous entry:
jelly belly
Next entry:
Jerne B-cells
Random entry:
Dendritic cell-specific ICAM-3-grabbing nonintegrin-2
Search COPE:

jerdostatin

The gene encoding this protein has been cloned from the genome of the Chinese Jerdons pit viper Trimeresurus jerdonii (Sanz et al, 2005). The protein (CTTGPCCRQCKLKPAGTTCWRTSVSSHYCTGRSCECPSYPG) contains a disintegrin domain with 80 % identity with that of obtustatin and viperistatin.

Jerdostatin is a potent and specific antagonist of the integrin integrin-alpha-1 / integrin-beta-1 (CD49a / CD29). Jerdostatin has been shown to inhibit binding of collagen type-4 to integrin-alpha-1 but not to other integrins (Juárez et al, 2010). Owing to its specificity of integrin binding it is expected to block angiogenesis in vivo (see also: Obtustatin).

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=28169