Fibronectin-derived Schwann cell inhibitor |
Fibronectin heparin-binding domain 2 |
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS |
||
For this bioactive fragment of fibronectin see: FNIII14 peptide.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |